PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G274000.2.p
Common NameSb03g032600, SORBIDRAFT_03g032600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 318aa    MW: 33800.2 Da    PI: 7.2693
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G274000.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.81.2e-181461148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          rg W++eEde+l+++++ +G g+W++++r  g+ R++k+c++rw +yl
  Sobic.003G274000.2.p 14 RGLWSPEEDEKLIKYITTHGHGCWSSVPRQAGLQRCGKSCRLRWINYL 61
                          788*******************************************97 PP

2Myb_DNA-binding52.11.6e-1667110146
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           rg+++++E+ l+v++++ lG++ W+ Ia++++ gRt++++k++w++
  Sobic.003G274000.2.p  67 RGSFSQQEEALIVELHRVLGNR-WAQIAKHLP-GRTDNEVKNFWNS 110
                           899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.7E-27664IPR009057Homeodomain-like
PROSITE profilePS5129418.665961IPR017930Myb domain
SuperFamilySSF466893.59E-2912108IPR009057Homeodomain-like
SMARTSM007172.6E-131363IPR001005SANT/Myb domain
PfamPF002495.6E-161461IPR001005SANT/Myb domain
CDDcd001672.91E-121761No hitNo description
PROSITE profilePS5129426.32162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-2565117IPR009057Homeodomain-like
SMARTSM007172.2E-1666114IPR001005SANT/Myb domain
PfamPF002495.4E-1567110IPR001005SANT/Myb domain
CDDcd001675.51E-1269109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MGHHSCCNKQ KVRRGLWSPE EDEKLIKYIT THGHGCWSSV PRQAGLQRCG KSCRLRWINY  60
LRPDLKRGSF SQQEEALIVE LHRVLGNRWA QIAKHLPGRT DNEVKNFWNS TIKKKLISQA  120
VGSLHPDLYY NILDGAAVQG LAAAGCAPLN GAADSASAQA AVGVTQSPPP MLHNNPAAWS  180
DFGSQPLFLP GHGGIHGGGG DLQYAAVDGE FVKQCRAADS YPPPEDGGGY ASQCKPPPAA  240
DVVPQQEGAM ARSLIPAVFL EPNKCAAGDF MPEPAMAPVM DFMEAILAGS SSTSAASASS  300
LDSFSANAGM QSHCWIP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-31141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9587340.0EU958734.1 Zea mays clone 1711992 MYB9 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002458384.10.0hypothetical protein SORBIDRAFT_03g032600
TrEMBLC5XI730.0C5XI73_SORBI; Putative uncharacterized protein Sb03g032600
STRINGSb03g032600.10.0(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13890.25e-76myb domain protein 26